TNFSF14 (Human) Recombinant Protein
  • TNFSF14 (Human) Recombinant Protein

TNFSF14 (Human) Recombinant Protein

Ref: AB-P7612
TNFSF14 (Human) Recombinant Protein

Información del producto

Human TNFSF14 (O43557, 74 a.a. - 240 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name TNFSF14
Gene Alias CD258|HVEML|LIGHT|LTg|TR2
Gene Description tumor necrosis factor (ligand) superfamily, member 14
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 8740

Enviar un mensaje


TNFSF14 (Human) Recombinant Protein

TNFSF14 (Human) Recombinant Protein