Fgfr3 (Mouse) Recombinant Protein
  • Fgfr3 (Mouse) Recombinant Protein

Fgfr3 (Mouse) Recombinant Protein

Ref: AB-P7610
Fgfr3 (Mouse) Recombinant Protein

Información del producto

Mouse Fgfr3 (Q61851-1, 21 a.a. - 374 a.a.) partial recombinant protein with mFc tag at C-terminus expressed in CHO cells.
Información adicional
Size 50 ug
Gene Name Fgfr3
Gene Alias Fgfr-3|HBGFR
Gene Description fibroblast growth factor receptor 3
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 14184

Enviar un mensaje


Fgfr3 (Mouse) Recombinant Protein

Fgfr3 (Mouse) Recombinant Protein