IL17D (Human) Recombinant Protein
  • IL17D (Human) Recombinant Protein

IL17D (Human) Recombinant Protein

Ref: AB-P7604
IL17D (Human) Recombinant Protein

Información del producto

Human IL17D (Q8TAD2, 18 a.a. - 202 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 100 ug
Gene Name IL17D
Gene Alias FLJ30846|IL-17D|IL-22|IL-27|IL27
Gene Description interleukin 17D
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 53342

Enviar un mensaje


IL17D (Human) Recombinant Protein

IL17D (Human) Recombinant Protein