Ver mas grande
NECTIN2 (Human) Recombinant Protein
AB-P7600
Producto nuevo
NECTIN2 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | PVRL2 |
| Gene Alias | CD112|HVEB|PRR2|PVRR2 |
| Gene Description | poliovirus receptor-related 2 (herpesvirus entry mediator B) |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVR |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 5819 |
Más información
Human NECTIN2 (Q92692-2, 32 a.a. - 360 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.