NECTIN2 (Human) Recombinant Protein
  • NECTIN2 (Human) Recombinant Protein

NECTIN2 (Human) Recombinant Protein

Ref: AB-P7600
NECTIN2 (Human) Recombinant Protein

Información del producto

Human NECTIN2 (Q92692-2, 32 a.a. - 360 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name PVRL2
Gene Alias CD112|HVEB|PRR2|PVRR2
Gene Description poliovirus receptor-related 2 (herpesvirus entry mediator B)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVR
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 5819

Enviar un mensaje


NECTIN2 (Human) Recombinant Protein

NECTIN2 (Human) Recombinant Protein