CD70 (Human) Recombinant Protein
  • CD70 (Human) Recombinant Protein

CD70 (Human) Recombinant Protein

Ref: AB-P7596
CD70 (Human) Recombinant Protein

Información del producto

Human CD70 (P32970, 39 a.a. - 193 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 1 mg
Gene Name CD70
Gene Alias CD27L|CD27LG|TNFSF7
Gene Description CD70 molecule
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 970

Enviar un mensaje


CD70 (Human) Recombinant Protein

CD70 (Human) Recombinant Protein