CD160 (Human) Recombinant Protein
  • CD160 (Human) Recombinant Protein

CD160 (Human) Recombinant Protein

Ref: AB-P7595
CD160 (Human) Recombinant Protein

Información del producto

Human CD160 (O95971, 27 a.a. - 159 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name CD160
Gene Alias BY55|FLJ46513|NK1|NK28
Gene Description CD160 molecule
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 11126

Enviar un mensaje


CD160 (Human) Recombinant Protein

CD160 (Human) Recombinant Protein