CD48 (Human) Recombinant Protein
  • CD48 (Human) Recombinant Protein

CD48 (Human) Recombinant Protein

Ref: AB-P7592
CD48 (Human) Recombinant Protein

Información del producto

Human CD96 (P09326, 27 a.a. - 220 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 1 mg
Gene Name CD48
Gene Alias BCM1|BLAST|BLAST1|MEM-102|SLAMF2|hCD48|mCD48
Gene Description CD48 molecule
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 962

Enviar un mensaje


CD48 (Human) Recombinant Protein

CD48 (Human) Recombinant Protein