TNFRSF4 (Human) Recombinant Protein
  • TNFRSF4 (Human) Recombinant Protein

TNFRSF4 (Human) Recombinant Protein

Ref: AB-P7587
TNFRSF4 (Human) Recombinant Protein

Información del producto

Human TNFRSF4 (P43489, 29 a.a. - 216 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 1 mg
Gene Name TNFRSF4
Gene Alias ACT35|CD134|OX40|TXGP1L
Gene Description tumor necrosis factor receptor superfamily, member 4
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 7293

Enviar un mensaje


TNFRSF4 (Human) Recombinant Protein

TNFRSF4 (Human) Recombinant Protein