Ver mas grande
PVR (Human) Recombinant Protein
AB-P7585
Producto nuevo
PVR (Human) Recombinant Protein
Comprando este producto generará 22 Biopuntos. Su cesta contiene un total 22 Biopuntos puede ser convertido en un Biobonos Descuento 88.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | PVR |
| Gene Alias | CD155|FLJ25946|HVED|NECL5|Necl-5|PVS|TAGE4 |
| Gene Description | poliovirus receptor |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPT |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 5817 |
Más información
Human PVR (P15151, 21 a.a. - 343 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.