PVR (Human) Recombinant Protein
  • PVR (Human) Recombinant Protein

PVR (Human) Recombinant Protein

Ref: AB-P7585
PVR (Human) Recombinant Protein

Información del producto

Human PVR (P15151, 21 a.a. - 343 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 1 mg
Gene Name PVR
Gene Alias CD155|FLJ25946|HVED|NECL5|Necl-5|PVS|TAGE4
Gene Description poliovirus receptor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPT
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 5817

Enviar un mensaje


PVR (Human) Recombinant Protein

PVR (Human) Recombinant Protein