Tgfb1 (Mouse) Recombinant Protein
  • Tgfb1 (Mouse) Recombinant Protein

Tgfb1 (Mouse) Recombinant Protein

Ref: AB-P7581
Tgfb1 (Mouse) Recombinant Protein

Información del producto

Mouse Tgfb1 (P04202, 279 a.a. - 390 a.a.) partial recombinant protein expressed in Human cells.
Información adicional
Size 10 ug
Gene Name Tgfb1
Gene Alias TGF-beta1|TGFbeta1|Tgfb|Tgfb-1
Gene Description transforming growth factor, beta 1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 21803

Enviar un mensaje


Tgfb1 (Mouse) Recombinant Protein

Tgfb1 (Mouse) Recombinant Protein