CD86 (Human) Recombinant Protein
  • CD86 (Human) Recombinant Protein

CD86 (Human) Recombinant Protein

Ref: AB-P7567
CD86 (Human) Recombinant Protein

Información del producto

Human CD86 (P42081, 20 a.a. - 247 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.
Información adicional
Size 1 mg
Gene Name CD86
Gene Alias B7-2|B70|CD28LG2|LAB72|MGC34413
Gene Description CD86 molecule
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 942

Enviar un mensaje


CD86 (Human) Recombinant Protein

CD86 (Human) Recombinant Protein