CD28 (Human) Recombinant Protein
  • CD28 (Human) Recombinant Protein

CD28 (Human) Recombinant Protein

Ref: AB-P7564
CD28 (Human) Recombinant Protein

Información del producto

Human CD28 (P10747, 19 a.a. - 152 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.
Información adicional
Size 1 mg
Gene Name CD28
Gene Alias MGC138290|Tp44
Gene Description CD28 molecule
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 940

Enviar un mensaje


CD28 (Human) Recombinant Protein

CD28 (Human) Recombinant Protein