ICOS (Human) Recombinant Protein
  • ICOS (Human) Recombinant Protein

ICOS (Human) Recombinant Protein

Ref: AB-P7563
ICOS (Human) Recombinant Protein

Información del producto

Human ICOS (Q9Y6W8, 21 a.a. - 141 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.
Información adicional
Size 50 ug
Gene Name ICOS
Gene Alias AILIM|CD278|MGC39850
Gene Description inducible T-cell co-stimulator
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 29851

Enviar un mensaje


ICOS (Human) Recombinant Protein

ICOS (Human) Recombinant Protein