Tnfrsf4 (Mouse) Recombinant Protein
  • Tnfrsf4 (Mouse) Recombinant Protein

Tnfrsf4 (Mouse) Recombinant Protein

Ref: AB-P7557
Tnfrsf4 (Mouse) Recombinant Protein

Información del producto

Mouse Tnfrsf4 (P47741, 20 a.a. - 211 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK294 cell.
Información adicional
Size 1 mg
Gene Name Tnfrsf4
Gene Alias ACT35|CD134|Ly-70|Ox40|TXGP1L|Txgp1
Gene Description tumor necrosis factor receptor superfamily, member 4
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 22163

Enviar un mensaje


Tnfrsf4 (Mouse) Recombinant Protein

Tnfrsf4 (Mouse) Recombinant Protein