GDNF (Human) Recombinant Protein
  • GDNF (Human) Recombinant Protein

GDNF (Human) Recombinant Protein

Ref: AB-P7550
GDNF (Human) Recombinant Protein

Información del producto

Human GDNF (P39905, 78 a.a. - 211 a.a.) partial recombinant protein expressed with an N-terminal Met in Escherichia coli.
Información adicional
Size 10 ug
Gene Name GDNF
Gene Alias ATF1|ATF2|HFB1-GDNF
Gene Description glial cell derived neurotrophic factor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 2668

Enviar un mensaje


GDNF (Human) Recombinant Protein

GDNF (Human) Recombinant Protein