CTLA4 (Human) Recombinant Protein
  • CTLA4 (Human) Recombinant Protein

CTLA4 (Human) Recombinant Protein

Ref: AB-P7539
CTLA4 (Human) Recombinant Protein

Información del producto

Human CTLA4 (P16410, 37 a.a. - 162 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in CHO cell.
Información adicional
Size 1 mg
Gene Name CTLA4
Gene Alias CD152|CELIAC3|CTLA-4|GSE|IDDM12
Gene Description cytotoxic T-lymphocyte-associated protein 4
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 1493

Enviar un mensaje


CTLA4 (Human) Recombinant Protein

CTLA4 (Human) Recombinant Protein