Ver mas grande
Il22 (Mouse) Recombinant Protein
AB-P7529
Producto nuevo
Il22 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Il22 |
| Gene Alias | IL-22|IL-TIF|Iltif |
| Gene Description | interleukin 22 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 50929 |
Más información
Mouse Il22 (Q9JJY9, 34 a.a. - 179 a.a.) partial recombinant protein expressed in CHO cell.