TNF (Porcine) Recombinant Protein
  • TNF (Porcine) Recombinant Protein

TNF (Porcine) Recombinant Protein

Ref: AB-P7523
TNF (Porcine) Recombinant Protein

Información del producto

Porcine TNF (P23563, 78 a.a. - 232 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name TNF
Gene Alias TNFa
Gene Description tumor necrosis factor (TNF superfamily, member 2)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 397086

Enviar un mensaje


TNF (Porcine) Recombinant Protein

TNF (Porcine) Recombinant Protein