MB (Human) Recombinant Protein
  • MB (Human) Recombinant Protein

MB (Human) Recombinant Protein

Ref: AB-P7511
MB (Human) Recombinant Protein

Información del producto

Human MB (P02144, 1 a.a. - 154 a.a.) partial recombinant protein with His tag at N-terminus expressed with additional N-terminal sequence (MHHHHHHDDDDK) in Escherichia coli.
Información adicional
Size 10 ug
Gene Name MB
Gene Alias MGC13548|PVALB
Gene Description myoglobin
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Form Liquid
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 20% glycerol)
Gene ID 4151

Enviar un mensaje


MB (Human) Recombinant Protein

MB (Human) Recombinant Protein