Il22 (Mouse) Recombinant Protein
  • Il22 (Mouse) Recombinant Protein

Il22 (Mouse) Recombinant Protein

Ref: AB-P7509
Il22 (Mouse) Recombinant Protein

Información del producto

MouseIl22 (Q9JJY9, 34 a.a. - 179 a.a.) partial recombinant protein expressed with an N-terminal Met in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Il22
Gene Alias IL-22|IL-TIF|Iltif
Gene Description interleukin 22
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 50929

Enviar un mensaje


Il22 (Mouse) Recombinant Protein

Il22 (Mouse) Recombinant Protein