IL15 (Human) Recombinant Protein Ver mas grande

IL15 (Human) Recombinant Protein

AB-P7502

Producto nuevo

IL15 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 10 ug
Gene Name IL15
Gene Alias IL-15|MGC9721
Gene Description interleukin 15
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 3600

Más información

Human IL15 (P40933, 49 a.a. - 162 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

IL15 (Human) Recombinant Protein

IL15 (Human) Recombinant Protein