Ver mas grande
Cxcl12 (Mouse) Recombinant Protein
AB-P7501
Producto nuevo
Cxcl12 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | Cxcl12 |
| Gene Alias | AI174028|PBSF|PBSF/SDF-1|SDF-1|Scyb12|Sdf1|Sdf1a|Sdf1b|TLSF|TLSF-a|TLSF-b|TPAR1 |
| Gene Description | chemokine (C-X-C motif) ligand 12 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 20315 |
Más información
Mouse Cxcl12 (Q4FJL5, 22 a.a. - 89 a.a.) partial recombinant protein expressed in CHO cell.