FGF8 (Human) Recombinant Protein
  • FGF8 (Human) Recombinant Protein

FGF8 (Human) Recombinant Protein

Ref: AB-P7494
FGF8 (Human) Recombinant Protein

Información del producto

Human FGF8 (P55075, 23 a.a. - 233 a.a.) partial recombinant protein expressed at N-terminus in Escherichia coli.
Información adicional
Size 10 ug
Gene Name FGF8
Gene Alias AIGF|HBGF-8|MGC149376
Gene Description fibroblast growth factor 8 (androgen-induced)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 2253

Enviar un mensaje


FGF8 (Human) Recombinant Protein

FGF8 (Human) Recombinant Protein