IGF1 (Human) Recombinant Protein
  • IGF1 (Human) Recombinant Protein

IGF1 (Human) Recombinant Protein

Ref: AB-P7493
IGF1 (Human) Recombinant Protein

Información del producto

Human IGF1 (P05019, 49 a.a. - 118 a.a.) partial recombinant protein expressed at N-terminus in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IGF1
Gene Alias IGFI
Gene Description insulin-like growth factor 1 (somatomedin C)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 3479

Enviar un mensaje


IGF1 (Human) Recombinant Protein

IGF1 (Human) Recombinant Protein