IHH (Human) Recombinant Protein
  • IHH (Human) Recombinant Protein

IHH (Human) Recombinant Protein

Ref: AB-P7479
IHH (Human) Recombinant Protein

Información del producto

Human IHH (Q14623, 28 a.a. - 202 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IHH
Gene Alias BDA1|HHG2
Gene Description Indian hedgehog homolog (Drosophila)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 3549

Enviar un mensaje


IHH (Human) Recombinant Protein

IHH (Human) Recombinant Protein