Pdgfa (Mouse) Recombinant Protein
  • Pdgfa (Mouse) Recombinant Protein

Pdgfa (Mouse) Recombinant Protein

Ref: AB-P7478
Pdgfa (Mouse) Recombinant Protein

Información del producto

Mouse Pdgfa (P20033, 87 a.a. - 211 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Pdgfa
Gene Alias -
Gene Description platelet derived growth factor, alpha
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 18590

Enviar un mensaje


Pdgfa (Mouse) Recombinant Protein

Pdgfa (Mouse) Recombinant Protein