CCL20 (Human) Recombinant Protein
  • CCL20 (Human) Recombinant Protein

CCL20 (Human) Recombinant Protein

Ref: AB-P7475
CCL20 (Human) Recombinant Protein

Información del producto

Human CCL20 (P78556, 27 a.a. - 96 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 5 ug
Gene Name CCL20
Gene Alias CKb4|LARC|MIP-3a|MIP3A|SCYA20|ST38
Gene Description chemokine (C-C motif) ligand 20
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from 53 mM Na2HPO4, 147 mM NaH2PO4, 300 mM NaCl, pH 6.5. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 6364

Enviar un mensaje


CCL20 (Human) Recombinant Protein

CCL20 (Human) Recombinant Protein