Ccl3 (Mouse) Recombinant Protein
  • Ccl3 (Mouse) Recombinant Protein

Ccl3 (Mouse) Recombinant Protein

Ref: AB-P7473
Ccl3 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl3 (Q5QNW0, 24 a.a. - 92 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 5 ug
Gene Name Ccl3
Gene Alias AI323804|G0S19-1|LD78alpha|MIP-1alpha|MIP1-(a)|MIP1-alpha|Mip1a|Scya3
Gene Description chemokine (C-C motif) ligand 3
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLEL NA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 20302

Enviar un mensaje


Ccl3 (Mouse) Recombinant Protein

Ccl3 (Mouse) Recombinant Protein