IL17A (Human) Recombinant Protein
  • IL17A (Human) Recombinant Protein

IL17A (Human) Recombinant Protein

Ref: AB-P7454
IL17A (Human) Recombinant Protein

Información del producto

Human IL17A (Q16552, 20 a.a. - 155 a.a.) partial recombinant protein with His tag expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name IL17A
Gene Alias CTLA8|IL-17|IL-17A|IL17
Gene Description interleukin 17A
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 3605

Enviar un mensaje


IL17A (Human) Recombinant Protein

IL17A (Human) Recombinant Protein