Fgf2 (Rat) Recombinant Protein
  • Fgf2 (Rat) Recombinant Protein

Fgf2 (Rat) Recombinant Protein

Ref: AB-P7432
Fgf2 (Rat) Recombinant Protein

Información del producto

Rat Fgf2 (P13109, 10 a.a. - 154 a.a.) partial recombinant protein with an N-terminal Gly expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Fgf2
Gene Alias Fgf-2|bFGF
Gene Description fibroblast growth factor 2
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 54250

Enviar un mensaje


Fgf2 (Rat) Recombinant Protein

Fgf2 (Rat) Recombinant Protein