Gdnf (Mouse) Recombinant Protein
  • Gdnf (Mouse) Recombinant Protein

Gdnf (Mouse) Recombinant Protein

Ref: AB-P7421
Gdnf (Mouse) Recombinant Protein

Información del producto

Mouse Gdnf (P48540, 77 a.a. - 211 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 5 ug
Gene Name Gdnf
Gene Alias AI385739
Gene Description glial cell line derived neurotrophic factor
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 14573

Enviar un mensaje


Gdnf (Mouse) Recombinant Protein

Gdnf (Mouse) Recombinant Protein