IL18BP (Human) Recombinant Protein
  • IL18BP (Human) Recombinant Protein

IL18BP (Human) Recombinant Protein

Ref: AB-P7420
IL18BP (Human) Recombinant Protein

Información del producto

Human IL18BP (O95998, 31 a.a. - 194 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name IL18BP
Gene Alias IL18BPa
Gene Description interleukin 18 binding protein
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 10068

Enviar un mensaje


IL18BP (Human) Recombinant Protein

IL18BP (Human) Recombinant Protein