Ver mas grande
Fgf7 (Mouse) Recombinant Protein
AB-P7410
Producto nuevo
Fgf7 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Fgf7 |
| Gene Alias | Kgf |
| Gene Description | fibroblast growth factor 7 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in PBS up to 100 ug/mL. |
| Gene ID | 14178 |
Más información
Mouse Fgf7 (P36363, 32 a.a. - 194 a.a.) partial recombinant protein expressed in Escherichia coli.