Fgf7 (Mouse) Recombinant Protein
  • Fgf7 (Mouse) Recombinant Protein

Fgf7 (Mouse) Recombinant Protein

Ref: AB-P7410
Fgf7 (Mouse) Recombinant Protein

Información del producto

Mouse Fgf7 (P36363, 32 a.a. - 194 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Fgf7
Gene Alias Kgf
Gene Description fibroblast growth factor 7
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in PBS up to 100 ug/mL.
Gene ID 14178

Enviar un mensaje


Fgf7 (Mouse) Recombinant Protein

Fgf7 (Mouse) Recombinant Protein