TGFA (Human) Recombinant Protein
  • TGFA (Human) Recombinant Protein

TGFA (Human) Recombinant Protein

Ref: AB-P7409
TGFA (Human) Recombinant Protein

Información del producto

Human TGFA (P01135, 40 a.a. - 89 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 5 ug
Gene Name TGFA
Gene Alias TFGA
Gene Description transforming growth factor, alpha
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 7039

Enviar un mensaje


TGFA (Human) Recombinant Protein

TGFA (Human) Recombinant Protein