IGF2 (Human) Recombinant Protein
  • IGF2 (Human) Recombinant Protein

IGF2 (Human) Recombinant Protein

Ref: AB-P7406
IGF2 (Human) Recombinant Protein

Información del producto

Human IGF2 ( P01344-1, 25 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IGF2
Gene Alias C11orf43|FLJ22066|FLJ44734|INSIGF|pp9974
Gene Description insulin-like growth factor 2 (somatomedin A)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 3481

Enviar un mensaje


IGF2 (Human) Recombinant Protein

IGF2 (Human) Recombinant Protein