Igf1 (Rat) Recombinant Protein
  • Igf1 (Rat) Recombinant Protein

Igf1 (Rat) Recombinant Protein

Ref: AB-P7405
Igf1 (Rat) Recombinant Protein

Información del producto

Rat Igf1 (P08025, 49 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Igf1
Gene Alias -
Gene Description insulin-like growth factor 1
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 24482

Enviar un mensaje


Igf1 (Rat) Recombinant Protein

Igf1 (Rat) Recombinant Protein