ACE2(Human) Recombinant Protein
  • ACE2(Human) Recombinant Protein

ACE2(Human) Recombinant Protein

Ref: AB-P7399
ACE2(Human) Recombinant Protein

Información del producto

Human ACE2 (Q9BYF1, 18 a.a. - 740 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 1 mg
Gene Name ACE2
Gene Alias ACEH|DKFZp434A014
Gene Description angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Storage Conditions Store at -20C or below for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG
Form Liquid
Antigen species Target species Human
Storage Buffer In PBS, pH 7.4.
Gene ID 59272

Enviar un mensaje


ACE2(Human) Recombinant Protein

ACE2(Human) Recombinant Protein