IL1RN (Human) Recombinant Protein
  • IL1RN (Human) Recombinant Protein

IL1RN (Human) Recombinant Protein

Ref: AB-P7384
IL1RN (Human) Recombinant Protein

Información del producto

Human IL1RN (P18510, 26 a.a. - 177 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name IL1RN
Gene Alias ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430
Gene Description interleukin 1 receptor antagonist
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 3557

Enviar un mensaje


IL1RN (Human) Recombinant Protein

IL1RN (Human) Recombinant Protein