Btc (Mouse) Recombinant Protein
  • Btc (Mouse) Recombinant Protein

Btc (Mouse) Recombinant Protein

Ref: AB-P7382
Btc (Mouse) Recombinant Protein

Información del producto

Mouse Btc (Q543J8, 32 a.a. - 111 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name Btc
Gene Alias -
Gene Description betacellulin, epidermal growth factor family member
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQT PSCICEKGYFGARCERVDLFY
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 12223

Enviar un mensaje


Btc (Mouse) Recombinant Protein

Btc (Mouse) Recombinant Protein