Cxcl1 (Mouse) Recombinant Protein
  • Cxcl1 (Mouse) Recombinant Protein

Cxcl1 (Mouse) Recombinant Protein

Ref: AB-P7380
Cxcl1 (Mouse) Recombinant Protein

Información del producto

Mouse Cxcl1 (P12850, 25 a.a. - 96 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 5 ug
Gene Name Cxcl1
Gene Alias Fsp|Gro1|KC|Mgsa|N51|Scyb1|gro
Gene Description chemokine (C-X-C motif) ligand 1
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 14825

Enviar un mensaje


Cxcl1 (Mouse) Recombinant Protein

Cxcl1 (Mouse) Recombinant Protein