FIGF (Human) Recombinant Protein Ver mas grande

FIGF (Human) Recombinant Protein

AB-P7373

Producto nuevo

FIGF (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 10 ug
Gene Name FIGF
Gene Alias VEGF-D|VEGFD
Gene Description c-fos induced growth factor (vascular endothelial growth factor D)
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL.
Gene ID 2277

Más información

Human FIGF (O43915, 89 a.a. - 205 a.a ) partial recombinant protein expressed in CHO cells.

Consulta sobre un producto

FIGF (Human) Recombinant Protein

FIGF (Human) Recombinant Protein