Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
Adipoq (Mouse) Recombinant Protein
Abnova
Adipoq (Mouse) Recombinant Protein
Ref: AB-P7368
Adipoq (Mouse) Recombinant Protein
Contáctenos
Información del producto
Mouse Adipoq (Q60994, 104 a.a. - 247 a.a.) V113M mutant partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
10 ug
Gene Name
Adipoq
Gene Alias
30kDa|APN|Acdc|Acrp30|GBP28|adipo|apM1
Gene Description
adiponectin, C1Q and collagen domain containing
Storage Conditions
Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
KGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Form
Lyophilized
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species
Mouse
Storage Buffer
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH
2
O up to 100 ug/mL.
Gene ID
11450
Enviar un mensaje
Adipoq (Mouse) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*