Il3 (Mouse) Recombinant Protein
  • Il3 (Mouse) Recombinant Protein

Il3 (Mouse) Recombinant Protein

Ref: AB-P7367
Il3 (Mouse) Recombinant Protein

Información del producto

Mouse Il3 (P01586, 33 a.a. - 166 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Il3
Gene Alias BPA|Csfmu|HCGF|Il-3|MCGF|PSF
Gene Description interleukin 3
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 16187

Enviar un mensaje


Il3 (Mouse) Recombinant Protein

Il3 (Mouse) Recombinant Protein