AREG (Human) Recombinant Protein
  • AREG (Human) Recombinant Protein

AREG (Human) Recombinant Protein

Ref: AB-P7362
AREG (Human) Recombinant Protein

Información del producto

Human AREG (P15514, 101 a.a. - 198 a.a ) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name AREG
Gene Alias AR|CRDGF|MGC13647|SDGF
Gene Description amphiregulin
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 374

Enviar un mensaje


AREG (Human) Recombinant Protein

AREG (Human) Recombinant Protein