Kitlg (Rat) Recombinant Protein
  • Kitlg (Rat) Recombinant Protein

Kitlg (Rat) Recombinant Protein

Ref: AB-P7354
Kitlg (Rat) Recombinant Protein

Información del producto

Rat Kitlg (P21581, 26 a.a. - 189 a.a.) partial recombinant protein expressed in Pichia pastoris expression system.
Información adicional
Size 10 ug
Gene Name Kitlg
Gene Alias Kitl|Mgf|SCF
Gene Description KIT ligand
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 60427

Enviar un mensaje


Kitlg (Rat) Recombinant Protein

Kitlg (Rat) Recombinant Protein