S100A1 (Human) Recombinant Protein Ver mas grande

S100A1 (Human) Recombinant Protein

AB-P7350

Producto nuevo

S100A1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.


Hoja técnica

Size 50 ug
Gene Name S100A1
Gene Alias S100|S100-alpha|S100A
Gene Description S100 calcium binding protein A1
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Form Lyophilized
Recomended Dilution SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from 20 mM Tris-HCl, 0.1 mM EDTA, pH 7.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O at 200 μg/ml. 
Gene ID 6271

Más información

Human S100A1 (P23297, 1 a.a. - 200 a.a ) full-length recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

S100A1 (Human) Recombinant Protein

S100A1 (Human) Recombinant Protein