Lif (Mouse) Recombinant Protein
  • Lif (Mouse) Recombinant Protein

Lif (Mouse) Recombinant Protein

Ref: AB-P7346
Lif (Mouse) Recombinant Protein

Información del producto

Mouse Lif (P09056, 24 a.a. - 203 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Lif
Gene Alias -
Gene Description leukemia inhibitory factor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from 50 mM Tris, 150 mM NaCl, pH 8.0. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 16878

Enviar un mensaje


Lif (Mouse) Recombinant Protein

Lif (Mouse) Recombinant Protein