Il17a (Mouse) Recombinant Protein
  • Il17a (Mouse) Recombinant Protein

Il17a (Mouse) Recombinant Protein

Ref: AB-P7330
Il17a (Mouse) Recombinant Protein

Información del producto

Mouse Il17a (Q62386, 26 a.a. - 158 a.a.) partial recombinant protein expressed in CHO cell.
Información adicional
Size 10 ug
Gene Name Il17a
Gene Alias Ctla-8|Ctla8|Il17
Gene Description interleukin 17A
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 16171

Enviar un mensaje


Il17a (Mouse) Recombinant Protein

Il17a (Mouse) Recombinant Protein