FGF18 (Human) Recombinant Protein Ver mas grande

FGF18 (Human) Recombinant Protein

AB-P7321

Producto nuevo

FGF18 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.


Hoja técnica

Size 10 ug
Gene Name FGF18
Gene Alias FGF-18|ZFGF5
Gene Description fibroblast growth factor 18
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL.
Gene ID 8817

Más información

Human FGF18 (O76093, 27 a.a. - 199 a.a ) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

FGF18 (Human) Recombinant Protein

FGF18 (Human) Recombinant Protein