Csf1 (Rat) Recombinant Protein
  • Csf1 (Rat) Recombinant Protein

Csf1 (Rat) Recombinant Protein

Ref: AB-P7320
Csf1 (Rat) Recombinant Protein

Información del producto

Rat Csf1 (Q8JZQ0, 33 a.a. - 186 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 5 ug
Gene Name Csf1
Gene Alias -
Gene Description colony stimulating factor 1 (macrophage)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKP
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 78965

Enviar un mensaje


Csf1 (Rat) Recombinant Protein

Csf1 (Rat) Recombinant Protein